6-in-1 spiraalcavitatie-afslankmachine

Professional 6-in-1 Spiral Cavitation System

Ultrasonic Cavitation and Radiofrequency for Body Contouring

The 6-in-1 Spiral Cavitation Machine is a multifunctional body-contouring platform developed for beauty salons, aesthetic spas, wellness clinics and professional body-sculpting studios.

The system combines ultrasonic cavitation, radiofrequency and four complementary treatment functions for customized body-contouring, skin-firming, cellulite-appearance and body-care programs.

Multiple treatment applicators and adjustable intensity settings allow trained practitioners to create protocols for the abdomen, thighs, buttocks, upper arms, hips, back, waist and suitable face and neck areas.

Six treatment functions | Ultrasonic cavitation | Radiofrequency | Three-year warranty

Four Professional Applications on One Body-Contouring Platform

Ultrasonic Cavitation

The Cavitation Handle delivers ultrasonic energy to suitable localized body areas.

Common applications include:

• 
  Abdomen treatments
  
• 
  Waist and flank programs
  
• 
  Thigh treatments
  
• 
  Upper-arm programs
  
• 
  Hip and back treatments
  
• 
  General body-contouring services
  

Radiofrequency Skin Firming

The RF function delivers controlled thermal energy for professional skin-firming and texture-refinement programs.

Common applications include:

• 
  Loose-looking body skin
  
• 
  Skin-firming support
  
• 
  Cellulite-appearance programs
  
• 
  Abdomen and thigh treatments
  
• 
  Suitable facial protocols
  
• 
  General rejuvenation services
  

Cellulite-Appearance and Texture Care

The system’s combined technologies can be incorporated into professional programs for uneven-looking body texture.

Common applications include:

• 
  Inner thighs
  
• 
  Outer thighs
  
• 
  Buttocks
  
• 
  Hips
  
• 
  Abdomen
  
• 
  Other professionally assessed body areas
  

Circulation and Drainage Support

Complementary treatment functions support professionally planned massage and circulation-focused body-care programs.

Common applications include:

• 
  Temporary water-retention support
  
• 
  Post-cavitation massage
  
• 
  General circulation-focused wellness
  
• 
  Body-care treatments
  
• 
  Muscle relaxation
  
• 
  Maintenance-oriented programs
  

The appropriate technology, applicator, energy level and session duration should be selected according to the treatment area, client condition and professional protocol.

Select the Right Treatment Program for Each Client

The system supports customized body-contouring pathways using one or more of its six functions.

Program 1: Abdomen and Waist Contouring

A body-focused program for suitable localized areas around the abdomen and waist.

Recommended technologies:

• 
  Ultrasonic Cavitation
  
• 
  Radiofrequency
  
• 
  Complementary Body-Care Functions
  
• 
  Post-Treatment Massage
  

Recommended for:

• 
  Upper abdomen
  
• 
  Lower abdomen
  
• 
  Waistline
  
• 
  Flanks and side body
  

Program 2: Thigh and Cellulite Appearance

A lower-body program designed for suitable inner- and outer-thigh concerns.

Recommended technologies:

• 
  Ultrasonic Cavitation
  
• 
  Radiofrequency
  
• 
  Texture-Refinement Function
  
• 
  Circulation-Support Treatment
  

Recommended for:

• 
  Inner thighs
  
• 
  Outer thighs
  
• 
  Buttocks
  
• 
  Cellulite-appearance programs
  

Program 3: Arms, Back and Hips

A customizable program for smaller or contoured body zones.

Recommended technologies:

• 
  Suitable Cavitation Applicator
  
• 
  Radiofrequency
  
• 
  Complementary Massage Function
  
• 
  Customized Lower-Intensity Settings
  

Recommended for:

• 
  Upper arms
  
• 
  Upper and lower back
  
• 
  Hips
  
• 
  Bra-line areas
  

Program 4: Face and Neck Firming

A gentler professional program using applicators and settings intended for suitable facial and neck areas.

Recommended technologies:

• 
  Suitable RF Applicator
  
• 
  Gentle Skin-Firming Program
  
• 
  Customized Low-Intensity Settings
  
• 
  Professional Facial Protocol
  

Recommended for:

• 
  Facial-contour refinement
  
• 
  Jawline treatments
  
• 
  Suitable neck areas
  
• 
  General skin-firming support
  

Adjustable Energy for Customized Treatments

The 6-in-1 Spiral Cavitation System provides adjustable intensity settings for different technologies and treatment areas.

Treatment SettingRecommended ApplicationLower IntensityFirst-time clients and smaller treatment areasModerate IntensityGeneral professional body-contouring treatmentsHigher IntensityAppropriately selected body areas and experienced clientsCustomized ProgramTechnology-specific settings based on professional assessment

The adjustable controls give trained practitioners greater flexibility over cavitation energy, RF intensity and client comfort.

New clients should begin with conservative settings before treatment intensity is increased gradually.

Adjustable Treatment Areas

The system supports professional treatment of multiple body and facial zones.

Upper-Body Treatments

• 
  Upper arms
  
• 
  Upper back
  
• 
  Lower back
  
• 
  Bra-line areas
  
• 
  Waist
  
• 
  Flanks
  

Lower-Body Treatments

• 
  Abdomen
  
• 
  Hips
  
• 
  Buttocks
  
• 
  Inner thighs
  
• 
  Outer thighs
  
• 
  Legs
  

Face and Neck Treatments

• 
  Suitable cheek areas
  
• 
  Jawline
  
• 
  Lower face
  
• 
  Appropriate neck areas
  
• 
  Other professionally assessed facial zones
  

Professional Body and Facial Applications

The available treatments depend on the selected technology, applicator, energy setting and professional protocol.

Treatment AreaApplicable TechnologyIntended Aesthetic ApplicationAbdomenCavitation and RFBody-contour refinementWaist and flanksCavitation and RFWaist-contouring supportInner and outer thighsCavitation and RFLower-body and texture careButtocksRF and complementary functionsFirming and cellulite-appearance supportUpper armsCavitation or RFTargeted body-care programsBack and hipsCavitation and RFLocalized contour refinementFace and jawlineSuitable RF ApplicatorFacial-contour programsNeckSuitable RF ApplicatorProfessional firming support

Treatment suitability and expected outcomes vary between clients. A complete consultation should be performed before every treatment.

How a Professional Treatment Session Works

1. Client Consultation

The practitioner reviews the client’s health history, treatment goals, body condition, target areas and contraindications.

2. Technology and Applicator Selection

The appropriate treatment applicators are selected according to the treatment area and intended body-contouring program.

3. Parameter Selection

The practitioner selects the cavitation intensity, RF energy and other available settings according to the client’s tolerance and professional protocol.

4. Multi-Technology Treatment

The selected technologies are applied in the appropriate sequence. A typical professional treatment lasts approximately 60 minutes.

5. Post-Treatment Guidance

After treatment, the areas are assessed and the client receives suitable hydration, activity and aftercare guidance.

Temporary redness, warmth, tenderness, tingling or sensitivity may occur depending on the selected technology and intensity.

Designed for Professional Treatment Environments

The system combines six treatment functions with digital controls and multiple applicators for streamlined professional operation.

Key operating advantages include:

• 
  Ultrasonic Cavitation
  
• 
  Radiofrequency Skin Firming
  
• 
  Six integrated treatment functions
  
• 
  Multiple treatment applicators
  
• 
  Adjustable intensity levels
  
• 
  LCD control interface
  
• 
  Preset treatment modes
  
• 
  Dual-voltage compatibility
  

Technical Specifications

SpecificationDetailsProduct Name6-in-1 Spiral Cavitation MachineProduct TypeProfessional multifunctional body-contouring systemNumber of FunctionsSixPrimary TechnologiesUltrasonic Cavitation and RadiofrequencyAdditional FunctionsFour complementary body-care modalitiesTreatment ApplicatorsMultiple heads for different body areas and functionsSession DurationApproximately 60 minutesTreatment AreasAbdomen, thighs, buttocks, arms, hips, back, waist, face and neckIntensity LevelsAdjustableControl InterfaceLCD screen with professional controlsPower Supply110V and 220VSafety FeaturesAutomatic shut-off, client-safety sensors and overload protectionWarrantyThree-year parts warrantySupportProfessional training and customer assistanceCertificatesCE and ISO certificates

What Is Included?

The package includes the main control system, treatment applicators and required operating accessories.

Standard Equipment

• 
  One 6-in-1 Spiral Cavitation main unit
  
• 
  Ultrasonic Cavitation Handle
  
• 
  Radiofrequency Treatment Handle
  
• 
  Complementary treatment applicators
  
• 
  Handle-connection components
  
• 
  Required treatment accessories
  
• 
  Power cable
  
• 
  English user manual
  
• 
  Operating guidance
  

Documentation and Training

• 
  English operating manual
  
• 
  Remote professional training
  
• 
  Machine installation guidance
  
• 
  Treatment-handle setup
  
• 
  Cavitation operation
  
• 
  RF-energy selection
  
• 
  Treatment-area guidance
  
• 
  Multi-technology sequencing
  
• 
  Client consultation guidance
  
• 
  Safety and contraindication instructions
  
• 
  Cleaning and maintenance guidance
  
• 
  Basic troubleshooting assistance
  
• 
  Training certificate after completion
  

Professional Training and Ongoing Support

Professional training covers:

• 
  Machine installation and setup
  
• 
  LCD control operation
  
• 
  Treatment-handle installation
  
• 
  Ultrasonic Cavitation operation
  
• 
  Radiofrequency settings
  
• 
  Applicator selection
  
• 
  Body-area assessment
  
• 
  Face and neck precautions
  
• 
  Multi-technology treatment sequencing
  
• 
  Client-comfort monitoring
  
• 
  Cleaning and routine maintenance
  
• 
  Safety procedures
  
• 
  Basic troubleshooting
  

A professional training certificate is provided after successful completion.

Three-Year Warranty

The 6-in-1 Spiral Cavitation Machine is supported by a three-year parts warranty, providing long-term protection for your equipment investment.

Warranty Coverage

Subject to the official warranty terms, eligible manufacturing defects involving the following components may be covered:

• 
  Main machine unit
  
• 
  Internal electronic components
  
• 
  LCD control system
  
• 
  Cavitation-generation components
  
• 
  Radiofrequency components
  
• 
  Original treatment handles
  
• 
  Handle and cable connections
  
• 
  Other eligible parts supplied with the machine
  

Technical Support Process

If a technical issue occurs, the support team will assist with:

1. 
   Remote inspection and fault identification
   
2. 
   Guided troubleshooting
   
3. 
   Confirmation of the affected component
   
4. 
   Warranty-eligibility review
   
5. 
   Replacement-part assistance when covered
   
6. 
   Installation guidance for eligible replacement parts
   

Warranty Exclusions

The warranty does not normally cover:

• 
  Accidental or cosmetic damage
  
• 
  Damage caused by misuse
  
• 
  Incorrect treatment-handle operation
  
• 
  Unauthorized repairs or modifications
  
• 
  Incorrect voltage or electrical connection
  
• 
  Improper cleaning, storage or maintenance
  
• 
  Normal wear of accessories and consumable items
  
• 
  Damage caused by failure to follow the user manual
  
• 
  Shipping or transportation arranged without authorization
  

The original order details, machine serial number, images and diagnostic videos may be required when requesting service.

Full coverage remains subject to the official warranty policy.

Safety and Contraindications

This system is professional cavitation and radiofrequency equipment and should only be operated by appropriately trained personnel.

A complete health assessment and contraindication review must be completed before treatment.

Treatment may not be suitable for individuals with:

• 
  Pregnancy or suspected pregnancy
  
• 
  Pacemakers or implanted electronic devices
  
• 
  Metal implants in or near the treatment area
  
• 
  Active cancer
  
• 
  Active or suspected blood clots
  
• 
  Severe cardiovascular or vascular conditions
  
• 
  Open wounds or active skin infections
  
• 
  Severe liver or kidney conditions
  
• 
  Bleeding disorders
  
• 
  Uncontrolled diabetes
  
• 
  Recent surgery
  
• 
  Reduced sensation
  
• 
  Uncontrolled medical conditions
  
• 
  Other contraindications listed in the operating manual
  

Cavitation must not be applied over the head, heart, breasts, kidneys, liver, reproductive organs, bone surfaces or other prohibited areas.

RF energy and cavitation intensity must be selected according to the treatment area, skin condition and client tolerance.

This is not an exhaustive contraindication list. Operators must follow the user manual, applicable professional standards and local regulations. Medical advice should be obtained whenever client suitability is uncertain.

Intended Professional Users

This system is suitable for:

• 
  Beauty salons
  
• 
  Professional spas
  
• 
  Aesthetic clinics
  
• 
  Wellness centers
  
• 
  Body-contouring studios
  
• 
  Trained independent practitioners
  
• 
  Qualified aesthetic professionals
  
• 
  Businesses expanding their body-treatment services
  

This machine is not intended for untrained or casual home use.

Why Choose the 6-in-1 Spiral Cavitation Machine?

Combine Six Treatment Functions

The system combines ultrasonic cavitation, radiofrequency and four complementary body-care functions in one professional platform.

Treat Multiple Body Areas

Multiple applicators support professional protocols for the abdomen, thighs, buttocks, arms, hips, back, waist and suitable facial areas.

Customize Every Session

Adjustable intensity and technology selection allow treatments to be adapted to the client’s condition and professional objectives.

Expand Your Service Menu

The machine supports body-contouring, skin-firming, cellulite-appearance, texture-refinement and suitable face and neck programs.

Protect Your Investment

The system includes a three-year parts warranty, CE and ISO certificates, professional training and customer support.

Frequently Asked Questions

How does ultrasonic cavitation work?

The Cavitation Handle delivers ultrasonic energy to suitable localized body areas for professionally planned contour-refinement programs.

How does radiofrequency complement cavitation?

Radiofrequency provides controlled thermal energy for skin-firming support and texture-refinement treatments.

What makes this a six-in-one system?

The machine combines ultrasonic cavitation, radiofrequency and four complementary professional body-care functions.

Which areas can be treated?

Suitable areas include the abdomen, waist, flanks, thighs, buttocks, upper arms, back, hips and selected face or neck areas using appropriate applicators.

How long does a session take?

A typical professional session lasts approximately 60 minutes. Treatment duration varies according to the number of areas and technologies selected.

How many sessions are recommended?

A typical professional treatment course may include approximately 8–12 sessions. The final number and interval depend on client condition, treatment area and professional assessment.

Is the treatment uncomfortable?

Clients may feel vibration or an audible tone during cavitation and warmth during RF treatment. Settings should remain within the client’s comfort level.

Is there downtime?

Many suitable clients can resume normal activities shortly after treatment. Temporary redness, warmth, tenderness or sensitivity may occur.

Are results permanent?

No permanent body-contouring outcome should be guaranteed. Results vary, and remaining fat cells can change size with future weight gain.

Is professional training included?

Professional training covers cavitation, RF, applicator selection, treatment sequencing, cleaning, maintenance and safety. A training certificate is provided.

What does the three-year warranty cover?

The three-year parts warranty covers eligible manufacturing defects affecting approved machine components, subject to the official warranty policy. Consumables, accidental damage, misuse and unauthorized modifications are excluded.

Does the machine include CE and ISO certificates?

CE and ISO certificates are included.

Add 6-in-1 Cavitation to Your Body-Contouring Business

The 6-in-1 Spiral Cavitation Machine combines:

1. 
   Ultrasonic Cavitation
   
2. 
   Radiofrequency Skin Firming
   
3. 
   Six integrated treatment functions
   
4. 
   Professional body and facial applications
   
5. 
   Three-year parts warranty and customer support
   

Contact Wikbeauty to order the machine or receive more information about its treatment functions, applicators and professional training.

Order Your 6-in-1 Spiral Cavitation Machine and Request Pricing

This 6-in-1 platform combines multiple body-care technologies in one system, helping professionals offer customizable contouring, firming, texture-care, and wellness treatments.

Key features include:

• 
  6 integrated treatment functions
  
• 
  Ultrasonic cavitation
  
• 
  Radiofrequency skin-firming function
  
• 
  4 complementary body-care modalities
  
• 
  Multiple treatment applicators
  
• 
  Adjustable intensity levels
  
• 
  Preset treatment modes
  
• 
  LCD professional control interface
  
• 
  Approximately 60-minute treatment sessions
  
• 
  Body and selected face/neck applications
  
• 
  Automatic shut-off
  
• 
  Client-safety sensors
  
• 
  Overload protection
  
• 
  110 V and 220 V compatibility
  
• 
  CE and ISO certificates
  
• 
  Three-year parts warranty
  
• 
  Professional training and customer assistance

Product Name: 6-in-1 Spiral Cavitation Machine

Product Type: Professional multifunctional body-contouring system

Number of Functions: 6

Primary Technologies: Ultrasonic Cavitation and Radiofrequency

Additional Functions: 4 complementary body-care modalities

Treatment Applicators: Multiple heads for different body areas and functions

Session Duration: Approximately 60 minutes

Treatment Areas: Abdomen, thighs, buttocks, arms, hips, back, waist, face, neck

Intensity Levels: Adjustable

Control Interface: LCD screen with professional controls

Power Supply: 110 V and 220 V

Safety Features: Automatic shut-off, client-safety sensors, overload protection

Warranty: Three-year parts warranty

The provided product information confirms:

• 
  1 × 6-in-1 Spiral Cavitation Main Unit
  
• 
  Ultrasonic Cavitation Handle
  
• 
  Radiofrequency Treatment Handle
  
• 
  Complementary Treatment Applicators
  
• 
  Handle-Connection Components
  
• 
  Required Treatment Accessories
  
• 
  Power Cable
  
• 
  English User Manual
  
• 
  Operating Guidance
  

The supplied information does not specify an exact delivery time, shipping carrier, package dimensions, package weight, shipping fee, customs duties, or import-tax terms, so I have not added those details.

Need multiple 6-in-1 Spiral Cavitation Machines for your beauty salon, aesthetic clinic, wellness center, body-contouring studio, or distribution business?

Wikbeauty offers volume purchasing options for larger orders.

You can visit our dedicated Volume Discount page or contact us directly for current bulk-order pricing and purchasing support.

For larger orders, the final applicator configuration, voltage option, accessories, and commercial terms should be confirmed on the quotation before purchase.