6-in-1 spiraalcavitatie-afslankmachine
$3,999.00
Excluded Tax
$3,999.00
$3,999.00
DESCRIPTION
Professional 6-in-1 Spiral Cavitation System
Ultrasonic Cavitation and Radiofrequency for Body Contouring
The 6-in-1 Spiral Cavitation Machine is a multifunctional body-contouring platform developed for beauty salons, aesthetic spas, wellness clinics and professional body-sculpting studios.
The system combines ultrasonic cavitation, radiofrequency and four complementary treatment functions for customized body-contouring, skin-firming, cellulite-appearance and body-care programs.
Multiple treatment applicators and adjustable intensity settings allow trained practitioners to create protocols for the abdomen, thighs, buttocks, upper arms, hips, back, waist and suitable face and neck areas.
Six treatment functions | Ultrasonic cavitation | Radiofrequency | Three-year warranty
Four Professional Applications on One Body-Contouring Platform
Ultrasonic Cavitation
The Cavitation Handle delivers ultrasonic energy to suitable localized body areas.
Common applications include:
Abdomen treatments
Waist and flank programs
Thigh treatments
Upper-arm programs
Hip and back treatments
General body-contouring services
Radiofrequency Skin Firming
The RF function delivers controlled thermal energy for professional skin-firming and texture-refinement programs.
Common applications include:
Loose-looking body skin
Skin-firming support
Cellulite-appearance programs
Abdomen and thigh treatments
Suitable facial protocols
General rejuvenation services
Cellulite-Appearance and Texture Care
The system’s combined technologies can be incorporated into professional programs for uneven-looking body texture.
Common applications include:
Inner thighs
Outer thighs
Buttocks
Hips
Abdomen
Other professionally assessed body areas
Circulation and Drainage Support
Complementary treatment functions support professionally planned massage and circulation-focused body-care programs.
Common applications include:
Temporary water-retention support
Post-cavitation massage
General circulation-focused wellness
Body-care treatments
Muscle relaxation
Maintenance-oriented programs
The appropriate technology, applicator, energy level and session duration should be selected according to the treatment area, client condition and professional protocol.
Select the Right Treatment Program for Each Client
The system supports customized body-contouring pathways using one or more of its six functions.
Program 1: Abdomen and Waist Contouring
A body-focused program for suitable localized areas around the abdomen and waist.
Recommended technologies:
Ultrasonic Cavitation
Radiofrequency
Complementary Body-Care Functions
Post-Treatment Massage
Recommended for:
Upper abdomen
Lower abdomen
Waistline
Flanks and side body
Program 2: Thigh and Cellulite Appearance
A lower-body program designed for suitable inner- and outer-thigh concerns.
Recommended technologies:
Ultrasonic Cavitation
Radiofrequency
Texture-Refinement Function
Circulation-Support Treatment
Recommended for:
Inner thighs
Outer thighs
Buttocks
Cellulite-appearance programs
Program 3: Arms, Back and Hips
A customizable program for smaller or contoured body zones.
Recommended technologies:
Suitable Cavitation Applicator
Radiofrequency
Complementary Massage Function
Customized Lower-Intensity Settings
Recommended for:
Upper arms
Upper and lower back
Hips
Bra-line areas
Program 4: Face and Neck Firming
A gentler professional program using applicators and settings intended for suitable facial and neck areas.
Recommended technologies:
Suitable RF Applicator
Gentle Skin-Firming Program
Customized Low-Intensity Settings
Professional Facial Protocol
Recommended for:
Facial-contour refinement
Jawline treatments
Suitable neck areas
General skin-firming support
Adjustable Energy for Customized Treatments
The 6-in-1 Spiral Cavitation System provides adjustable intensity settings for different technologies and treatment areas.
Treatment SettingRecommended ApplicationLower IntensityFirst-time clients and smaller treatment areasModerate IntensityGeneral professional body-contouring treatmentsHigher IntensityAppropriately selected body areas and experienced clientsCustomized ProgramTechnology-specific settings based on professional assessment
The adjustable controls give trained practitioners greater flexibility over cavitation energy, RF intensity and client comfort.
New clients should begin with conservative settings before treatment intensity is increased gradually.
Adjustable Treatment Areas
The system supports professional treatment of multiple body and facial zones.
Upper-Body Treatments
Upper arms
Upper back
Lower back
Bra-line areas
Waist
Flanks
Lower-Body Treatments
Abdomen
Hips
Buttocks
Inner thighs
Outer thighs
Legs
Face and Neck Treatments
Suitable cheek areas
Jawline
Lower face
Appropriate neck areas
Other professionally assessed facial zones
Professional Body and Facial Applications
The available treatments depend on the selected technology, applicator, energy setting and professional protocol.
Treatment AreaApplicable TechnologyIntended Aesthetic ApplicationAbdomenCavitation and RFBody-contour refinementWaist and flanksCavitation and RFWaist-contouring supportInner and outer thighsCavitation and RFLower-body and texture careButtocksRF and complementary functionsFirming and cellulite-appearance supportUpper armsCavitation or RFTargeted body-care programsBack and hipsCavitation and RFLocalized contour refinementFace and jawlineSuitable RF ApplicatorFacial-contour programsNeckSuitable RF ApplicatorProfessional firming support
Treatment suitability and expected outcomes vary between clients. A complete consultation should be performed before every treatment.
How a Professional Treatment Session Works
1. Client Consultation
The practitioner reviews the client’s health history, treatment goals, body condition, target areas and contraindications.
2. Technology and Applicator Selection
The appropriate treatment applicators are selected according to the treatment area and intended body-contouring program.
3. Parameter Selection
The practitioner selects the cavitation intensity, RF energy and other available settings according to the client’s tolerance and professional protocol.
4. Multi-Technology Treatment
The selected technologies are applied in the appropriate sequence. A typical professional treatment lasts approximately 60 minutes.
5. Post-Treatment Guidance
After treatment, the areas are assessed and the client receives suitable hydration, activity and aftercare guidance.
Temporary redness, warmth, tenderness, tingling or sensitivity may occur depending on the selected technology and intensity.
Designed for Professional Treatment Environments
The system combines six treatment functions with digital controls and multiple applicators for streamlined professional operation.
Key operating advantages include:
Ultrasonic Cavitation
Radiofrequency Skin Firming
Six integrated treatment functions
Multiple treatment applicators
Adjustable intensity levels
LCD control interface
Preset treatment modes
Dual-voltage compatibility
Technical Specifications
SpecificationDetailsProduct Name6-in-1 Spiral Cavitation MachineProduct TypeProfessional multifunctional body-contouring systemNumber of FunctionsSixPrimary TechnologiesUltrasonic Cavitation and RadiofrequencyAdditional FunctionsFour complementary body-care modalitiesTreatment ApplicatorsMultiple heads for different body areas and functionsSession DurationApproximately 60 minutesTreatment AreasAbdomen, thighs, buttocks, arms, hips, back, waist, face and neckIntensity LevelsAdjustableControl InterfaceLCD screen with professional controlsPower Supply110V and 220VSafety FeaturesAutomatic shut-off, client-safety sensors and overload protectionWarrantyThree-year parts warrantySupportProfessional training and customer assistanceCertificatesCE and ISO certificates
What Is Included?
The package includes the main control system, treatment applicators and required operating accessories.
Standard Equipment
One 6-in-1 Spiral Cavitation main unit
Ultrasonic Cavitation Handle
Radiofrequency Treatment Handle
Complementary treatment applicators
Handle-connection components
Required treatment accessories
Power cable
English user manual
Operating guidance
Documentation and Training
English operating manual
Remote professional training
Machine installation guidance
Treatment-handle setup
Cavitation operation
RF-energy selection
Treatment-area guidance
Multi-technology sequencing
Client consultation guidance
Safety and contraindication instructions
Cleaning and maintenance guidance
Basic troubleshooting assistance
Training certificate after completion
Professional Training and Ongoing Support
Professional training covers:
Machine installation and setup
LCD control operation
Treatment-handle installation
Ultrasonic Cavitation operation
Radiofrequency settings
Applicator selection
Body-area assessment
Face and neck precautions
Multi-technology treatment sequencing
Client-comfort monitoring
Cleaning and routine maintenance
Safety procedures
Basic troubleshooting
A professional training certificate is provided after successful completion.
Three-Year Warranty
The 6-in-1 Spiral Cavitation Machine is supported by a three-year parts warranty, providing long-term protection for your equipment investment.
Warranty Coverage
Subject to the official warranty terms, eligible manufacturing defects involving the following components may be covered:
Main machine unit
Internal electronic components
LCD control system
Cavitation-generation components
Radiofrequency components
Original treatment handles
Handle and cable connections
Other eligible parts supplied with the machine
Technical Support Process
If a technical issue occurs, the support team will assist with:
Remote inspection and fault identification
Guided troubleshooting
Confirmation of the affected component
Warranty-eligibility review
Replacement-part assistance when covered
Installation guidance for eligible replacement parts
Warranty Exclusions
The warranty does not normally cover:
Accidental or cosmetic damage
Damage caused by misuse
Incorrect treatment-handle operation
Unauthorized repairs or modifications
Incorrect voltage or electrical connection
Improper cleaning, storage or maintenance
Normal wear of accessories and consumable items
Damage caused by failure to follow the user manual
Shipping or transportation arranged without authorization
The original order details, machine serial number, images and diagnostic videos may be required when requesting service.
Full coverage remains subject to the official warranty policy.
Safety and Contraindications
This system is professional cavitation and radiofrequency equipment and should only be operated by appropriately trained personnel.
A complete health assessment and contraindication review must be completed before treatment.
Treatment may not be suitable for individuals with:
Pregnancy or suspected pregnancy
Pacemakers or implanted electronic devices
Metal implants in or near the treatment area
Active cancer
Active or suspected blood clots
Severe cardiovascular or vascular conditions
Open wounds or active skin infections
Severe liver or kidney conditions
Bleeding disorders
Uncontrolled diabetes
Recent surgery
Reduced sensation
Uncontrolled medical conditions
Other contraindications listed in the operating manual
Cavitation must not be applied over the head, heart, breasts, kidneys, liver, reproductive organs, bone surfaces or other prohibited areas.
RF energy and cavitation intensity must be selected according to the treatment area, skin condition and client tolerance.
This is not an exhaustive contraindication list. Operators must follow the user manual, applicable professional standards and local regulations. Medical advice should be obtained whenever client suitability is uncertain.
Intended Professional Users
This system is suitable for:
Beauty salons
Professional spas
Aesthetic clinics
Wellness centers
Body-contouring studios
Trained independent practitioners
Qualified aesthetic professionals
Businesses expanding their body-treatment services
This machine is not intended for untrained or casual home use.
Why Choose the 6-in-1 Spiral Cavitation Machine?
Combine Six Treatment Functions
The system combines ultrasonic cavitation, radiofrequency and four complementary body-care functions in one professional platform.
Treat Multiple Body Areas
Multiple applicators support professional protocols for the abdomen, thighs, buttocks, arms, hips, back, waist and suitable facial areas.
Customize Every Session
Adjustable intensity and technology selection allow treatments to be adapted to the client’s condition and professional objectives.
Expand Your Service Menu
The machine supports body-contouring, skin-firming, cellulite-appearance, texture-refinement and suitable face and neck programs.
Protect Your Investment
The system includes a three-year parts warranty, CE and ISO certificates, professional training and customer support.
Frequently Asked Questions
How does ultrasonic cavitation work?
The Cavitation Handle delivers ultrasonic energy to suitable localized body areas for professionally planned contour-refinement programs.
How does radiofrequency complement cavitation?
Radiofrequency provides controlled thermal energy for skin-firming support and texture-refinement treatments.
What makes this a six-in-one system?
The machine combines ultrasonic cavitation, radiofrequency and four complementary professional body-care functions.
Which areas can be treated?
Suitable areas include the abdomen, waist, flanks, thighs, buttocks, upper arms, back, hips and selected face or neck areas using appropriate applicators.
How long does a session take?
A typical professional session lasts approximately 60 minutes. Treatment duration varies according to the number of areas and technologies selected.
How many sessions are recommended?
A typical professional treatment course may include approximately 8–12 sessions. The final number and interval depend on client condition, treatment area and professional assessment.
Is the treatment uncomfortable?
Clients may feel vibration or an audible tone during cavitation and warmth during RF treatment. Settings should remain within the client’s comfort level.
Is there downtime?
Many suitable clients can resume normal activities shortly after treatment. Temporary redness, warmth, tenderness or sensitivity may occur.
Are results permanent?
No permanent body-contouring outcome should be guaranteed. Results vary, and remaining fat cells can change size with future weight gain.
Is professional training included?
Professional training covers cavitation, RF, applicator selection, treatment sequencing, cleaning, maintenance and safety. A training certificate is provided.
What does the three-year warranty cover?
The three-year parts warranty covers eligible manufacturing defects affecting approved machine components, subject to the official warranty policy. Consumables, accidental damage, misuse and unauthorized modifications are excluded.
Does the machine include CE and ISO certificates?
CE and ISO certificates are included.
Add 6-in-1 Cavitation to Your Body-Contouring Business
The 6-in-1 Spiral Cavitation Machine combines:
Ultrasonic Cavitation
Radiofrequency Skin Firming
Six integrated treatment functions
Professional body and facial applications
Three-year parts warranty and customer support
Contact Wikbeauty to order the machine or receive more information about its treatment functions, applicators and professional training.
Order Your 6-in-1 Spiral Cavitation Machine and Request Pricing
WHY CHOOSE WIKBEAUTY®
This 6-in-1 platform combines multiple body-care technologies in one system, helping professionals offer customizable contouring, firming, texture-care, and wellness treatments.
Key features include:
6 integrated treatment functions
Ultrasonic cavitation
Radiofrequency skin-firming function
4 complementary body-care modalities
Multiple treatment applicators
Adjustable intensity levels
Preset treatment modes
LCD professional control interface
Approximately 60-minute treatment sessions
Body and selected face/neck applications
Automatic shut-off
Client-safety sensors
Overload protection
110 V and 220 V compatibility
CE and ISO certificates
Three-year parts warranty
Professional training and customer assistance
SPECIFICATIONS
Product Name: 6-in-1 Spiral Cavitation Machine
Product Type: Professional multifunctional body-contouring system
Number of Functions: 6
Primary Technologies: Ultrasonic Cavitation and Radiofrequency
Additional Functions: 4 complementary body-care modalities
Treatment Applicators: Multiple heads for different body areas and functions
Session Duration: Approximately 60 minutes
Treatment Areas: Abdomen, thighs, buttocks, arms, hips, back, waist, face, neck
Intensity Levels: Adjustable
Control Interface: LCD screen with professional controls
Power Supply: 110 V and 220 V
Safety Features: Automatic shut-off, client-safety sensors, overload protection
Warranty: Three-year parts warranty
DELIVERY
The provided product information confirms:
1 × 6-in-1 Spiral Cavitation Main Unit
Ultrasonic Cavitation Handle
Radiofrequency Treatment Handle
Complementary Treatment Applicators
Handle-Connection Components
Required Treatment Accessories
Power Cable
English User Manual
Operating Guidance
The supplied information does not specify an exact delivery time, shipping carrier, package dimensions, package weight, shipping fee, customs duties, or import-tax terms, so I have not added those details.
VOLUME DISCOUNT
Need multiple 6-in-1 Spiral Cavitation Machines for your beauty salon, aesthetic clinic, wellness center, body-contouring studio, or distribution business?
Wikbeauty offers volume purchasing options for larger orders.
You can visit our dedicated Volume Discount page or contact us directly for current bulk-order pricing and purchasing support.
For larger orders, the final applicator configuration, voltage option, accessories, and commercial terms should be confirmed on the quotation before purchase.
ROI Calculator
See your investment recovery timeline

Professional 6-in-1 Cavitation System with Multi-Function Treatment Handles
The 6-in-1 Spiral Cavitation Machine combines ultrasonic cavitation, radiofrequency, and four complementary body-care functions in one professional platform. Its multiple treatment applicators and adjustable settings allow trained practitioners to customize protocols for the abdomen, waist, thighs, buttocks, arms, hips, back, and suitable face or neck areas.

Adjustable RF Treatment Interface for Customized Face & Body Care
The RF operating interface allows trained practitioners to customize treatment settings according to the selected applicator and treatment area. The system provides adjustable intensity from 1–15 J and treatment time from 1–60 minutes, with selectable modes for the Face Head, Medium Adsorption Head, Body Head, Large Adsorption Head, and Massage Head.
The RF function should be used with the electrode patch where required, and settings should be selected according to the client’s skin condition, treatment area, comfort, and professional protocol.
At a glance
Our achievements
1. What is the Wikbeauty 6-in-1 Spiral Cavitation Machine?
The Wikbeauty 6-in-1 Spiral Cavitation Machine is a professional multifunctional system combining ultrasonic cavitation, radiofrequency, and four complementary body-care functions for body contouring, skin firming, cellulite-appearance care, and selected facial treatments.
2. How does ultrasonic cavitation work?
The cavitation handle delivers ultrasonic energy to suitable localized body areas as part of professionally planned contour-refinement programs.
3. How does radiofrequency complement cavitation?
Radiofrequency delivers controlled thermal energy to support skin-firming and texture-refinement treatments.
4. What makes this a 6-in-1 machine?
The system combines ultrasonic cavitation, radiofrequency, and four additional professional body-care functions in one platform.
5. Which body areas can be treated?
Suitable areas include the abdomen, waist, flanks, thighs, buttocks, upper arms, back, hips, and selected face or neck areas using appropriate applicators.
6. Can the machine be used for facial treatments?
Yes. Suitable RF applicators and lower-intensity settings can be used for professionally assessed areas such as the jawline, lower face, cheeks, and neck.
7. How long does one treatment session take?
A typical professional session lasts approximately 60 minutes, although treatment time varies depending on the number of areas and technologies selected.
8. How many sessions are recommended?
A typical professional treatment course may include approximately 8–12 sessions. The final number and interval should depend on the treatment area, client condition, and professional assessment.
9. Can treatment intensity be adjusted?
Yes. The system provides adjustable intensity settings for different technologies and treatment areas, allowing practitioners to tailor sessions according to client comfort and professional protocol.
10. What does the treatment feel like?
Clients may feel vibration or an audible tone during cavitation and warmth during RF treatment. Settings should remain within the client’s comfort level.
11. Is there downtime after treatment?
Many suitable clients can return to normal activities shortly after treatment. Temporary redness, warmth, tenderness, or sensitivity may occur.
12. Can the machine help with cellulite-appearance treatments?
Yes. The system can be incorporated into professional programs for cellulite appearance and uneven-looking body texture, particularly on the thighs, buttocks, hips, and abdomen.
Discover Machines to Grow Your Practice
- Als u een selectie maakt, wordt de hele pagina vernieuwd.
- Opent in een nieuw venster.